Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0817300_circ_g.4 |
| ID in PlantcircBase | osa_circ_017188 |
| Alias | Os_ciR8213 |
| Organism | Oryza sativa |
| Position | chr2: 35058545-35059791 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0817200 |
| Parent gene annotation |
WD-40 repeat containing protein. (Os02t0817200-01);Similar to ac tin-related protein 2/3 complex subunit 1B. (Os02t0817200-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0817300_circ_g.3 Os02g0817300_circ_g.5 Os02g0817300_circ_g.6 Os02g0817300_circ_g.7 Os02g0817300_circ_g.8 |
| Support reads | 2/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0817300-00:4 Os02t0817300-00:4 Os02t0817200-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012482 |
| PMCS | 0.150990912 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35059737-35058575(+) 35059774-35058746(+) |
| Potential amino acid sequence |
MKVDNTLHLPSVDVVARSIKVQSHLQKRS*(+) MLLQEVSKSSLICRKDHRIAIKSNTNHRPFRKKKNITERQITQC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |