Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0162100_circ_g.9 |
| ID in PlantcircBase | osa_circ_036007 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 3669666-3670011 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os08g0162100 |
| Parent gene annotation |
Transcriptional co-repressor, Regulation of meristem fate (Os08t 0162100-01);Similar to predicted protein. (Os08t0162100-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0162100_circ_g.2 Os08g0162100_circ_g.3 Os08g0162100_circ_g.4 Os08g0162100_circ_g.5 Os08g0162100_circ_g.6 Os08g0162100_circ_g.7 Os08g0162100_circ_g.8 Os08g0162100_circ_g.10 Os08g0162100_circ_g.11 Os08g0162100_circ_g.12 Os08g0162100_circ_g.13 Os08g0162100_circ_g.14 Os08g0162100_circ_g.15 Os08g0162100_circ_g.16 Os08g0162100_circ_g.17 Os08g0162100_circ_g.18 Os08g0162100_circ_g.19 Os08g0162100_circ_g.20 Os08g0162100_circ_g.21 Os08g0162100_circ_g.22 |
| Support reads | 24 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0162100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.290531262 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3669744-3670008(+) 3669713-3669994(-) |
| Potential amino acid sequence |
MKRMRVGQPDEVSFSGASHPANIYTQDDLPKQVVRNLNQGSNVMSLDFHPVQQTILLAAFLKHP RTPTSAPAIDYQSADSEHLMKRMRVGQPDEVSFSGASHPANIYTQDDLPKQVVRNLNQGSNVMS LDFHPVQQTILLAAFLKHPRTPTSAPAIDYQSADSEHLMKRMRVGQPDEVSFSGASHPANIYTQ DDLPKQVVRNLNQGSNVMSLDFHPVQQTILLAAFLKHPRTPTSAPAIDYQSADSEHLMKRMRVG QPDEVSFSGASHPANIYTQDDLPKQVVRNLNQGSNVMSLDFHPVQQTILL(+) MAGALVGVLGCFRNAARRMVC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |