Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0162100_circ_g.7 |
ID in PlantcircBase | osa_circ_036005 |
Alias | Os_ciR5029 |
Organism | Oryza sativa |
Position | chr8: 3669182-3670220 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os08g0162100 |
Parent gene annotation |
Transcriptional co-repressor, Regulation of meristem fate (Os08t 0162100-01);Similar to predicted protein. (Os08t0162100-02) |
Parent gene strand | + |
Alternative splicing | Os08g0162100_circ_g.2 Os08g0162100_circ_g.3 Os08g0162100_circ_g.4 Os08g0162100_circ_g.5 Os08g0162100_circ_g.6 Os08g0162100_circ_g.8 Os08g0162100_circ_g.9 Os08g0162100_circ_g.10 Os08g0162100_circ_g.11 Os08g0162100_circ_g.12 Os08g0162100_circ_g.13 Os08g0162100_circ_g.14 Os08g0162100_circ_g.15 Os08g0162100_circ_g.16 Os08g0162100_circ_g.17 Os08g0162100_circ_g.18 Os08g0162100_circ_g.19 Os08g0162100_circ_g.20 Os08g0162100_circ_g.21 Os08g0162100_circ_g.22 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0162100-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.278924992 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3669349-3669184(+) |
Potential amino acid sequence |
MGAHAPFQPVVSPSPNAIAGWMTNANPSLPHAAVAQGPPGLVQPPNTAAFLKHPRTPTSAPAID YQSADSEHLMKRMRVGQPDEVSFSGASHPANIYTQDDLPKQVVRNLNQGSNVMSLDFHPVQQTI LLVGTNVGDIGIWEVGSRERIAHKTFKVWDISSCTLPLQS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |