Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0545000_circ_g.3 |
| ID in PlantcircBase | osa_circ_009542 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 20046091-20046267 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0545000 |
| Parent gene annotation |
NOP5, N-terminal domain containing protein. (Os11t0545000-01);Co nserved hypothetical protein. (Os11t0545000-02);NOP5, N-terminal domain containing protein. (Os11t0545000-03) |
| Parent gene strand | - |
| Alternative splicing | Os11g0544900_circ_ag.1 Os11g0545000_circ_g.1 Os11g0545000_circ_g.2 Os11g0545000_circ_g.4 Os11g0545000_circ_g.5 Os11g0545000_circ_g.6 Os11g0545000_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0545000-03:1 Os11t0545000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.092749529 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20046207-20046115(+) 20046239-20046093(-) |
| Potential amino acid sequence |
MRRFMAHITSITTSSHRQGIPISGLISKP*(+) MDVMWAMKRLIRYFVPTETPELAEEDSLTMSQGLRMFLSRYGFEIKPEMGIPCLCDEVVMDVMW AMKRLIRYFVPTETPELAEEDSLTMSQGLRMFLSRYGFEIKPEMGIPCLCDEVVMDVMWAMKRL IRYFVPTETPELAEEDSLTMSQGLRMFLSRYGFEIKPEMGIPCLCDEVVMDVMWAMKRLIRYFV PTETPELAEEDSLTMSQGLRMFLSRYGFEIKPEM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |