Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0592500_circ_g.8 |
| ID in PlantcircBase | osa_circ_029180 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 29523805-29525250 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0592500 |
| Parent gene annotation |
SIT4 phosphatase-associated protein family protein. (Os05t059250 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0592500_circ_g.3 Os05g0592500_circ_g.4 Os05g0592500_circ_g.5 Os05g0592500_circ_g.6 Os05g0592500_circ_g.7 Os05g0592500_circ_g.9 Os05g0592500_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0592500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.234384359 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29523993-29523933(+) 29523934-29525243(-) |
| Potential amino acid sequence |
MLESLGDLLKLLDISSAENVLPTTYGCLQPPLGKHRLKIVEFISVLLTIGSETAEQELINQSAV KRSIDLFFQYPYNNFLHHHVESIIISCLEVNRSQLIDHALNECNLVGKILAAERSSSLSTESNT PTLLSEGKVPPKIGNIGHITRIANKLIQLGNSNSIIQSHLQFCWEIISSCSSRITPQICPGSFI ISMYIFVGSKKTSVSLIPSI*(+) MLGMRLTLVFLDPTKIYILIMNEPGQIWGVILEEHDEIISQQNCK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |