Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0278550_circ_g.3 |
ID in PlantcircBase | osa_circ_023262 |
Alias | Os_ciR9252 |
Organism | Oryza sativa |
Position | chr4: 11767566-11773015 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0278550 |
Parent gene annotation |
Hypothetical protein. (Os04t0278550-00) |
Parent gene strand | - |
Alternative splicing | Os04g0278200_circ_g.1 Os04g0278550_circ_g.1 Os04g0278550_circ_g.2 Os04g0278550_circ_g.4 Os04g0278550_circ_g.5 Os04g0278550_circ_g.6 Os04g0278550_circ_g.7 Os04g0278550_circ_g.8 Os04g0278550_circ_g.9 Os04g0278550_circ_g.10 Os04g0278550_circ_g.11 Os04g0278550_circ_g.12 Os04g0278550_circ_g.13 Os04g0278550_circ_g.14 Os04g0278550_circ_g.15 Os04g0278550_circ_g.16 Os04g0278550_circ_g.17 Os04g0278550_circ_g.18 Os04g0278550_circ_g.19 |
Support reads | 2/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0278200-01:5 Os04t0278200-02:5 Os04t0278200-01:5 Os04t0278550-00:3 Os04t0278200-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.092199419 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11772966-11773012(+) |
Potential amino acid sequence |
MGIGHPEYASTMYLLGKRNLDEAEKFFQAALHEAKEGFGLRDPHVASALNNLAEFYRLKKEYEK AELLYLEAIEILEESFGSDDIRVGTALHSLGICYHLQRKFALAQTCYERALKIEGRVMGIGHPE YASTMYLLGKRNLDEAEKFFQAALHEAKEGFGLRDPHVASALNNLAEFYRLKKEYEKAELLYLE AIEILEESFGSDDIRVGTALHSLGICYHLQRKFALAQTCYERALKIEGRVMGIGHPEYASTMYL LGKRNLDEAEKFFQAALHEAKEGFGLRDPHVASALNNLAEFYRLKKEYEKAELLYLEAIEILEE SFGSDDIRVGTALHSLGICYHLQRKFALAQTCYERALKIEGRVMGIGHPEYASTMYLLGK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |