Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0278550_circ_g.10 |
| ID in PlantcircBase | osa_circ_023269 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 11772950-11774675 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0278550 |
| Parent gene annotation |
Hypothetical protein. (Os04t0278550-00) |
| Parent gene strand | - |
| Alternative splicing | Os04g0278200_circ_g.1 Os04g0278550_circ_g.1 Os04g0278550_circ_g.2 Os04g0278550_circ_g.3 Os04g0278550_circ_g.4 Os04g0278550_circ_g.5 Os04g0278550_circ_g.6 Os04g0278550_circ_g.7 Os04g0278550_circ_g.8 Os04g0278550_circ_g.9 Os04g0278550_circ_g.11 Os04g0278550_circ_g.12 Os04g0278550_circ_g.13 Os04g0278550_circ_g.14 Os04g0278550_circ_g.15 Os04g0278550_circ_g.16 Os04g0278550_circ_g.17 Os04g0278550_circ_g.18 Os04g0278550_circ_g.19 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0278200-01:3 Os04t0278200-02:3 Os04t0278550-00:2 Os04t0278200-01:3 Os04t0278200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015170 |
| PMCS | 0.101201777 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11772966-11774672(+) 11774646-11774510(+) 11772981-11774639(-) |
| Potential amino acid sequence |
MGIGHPEYASTMYLLGKVLSQQGKDAEALIEESIRILEESGLGESPICIQRMRYLSTIEGRVMG IGHPEYASTMYLLGKVLSQQGKDAEALIEESIRILEESGLGESPICIQRMRYLSTIEGRVMGIG HPEYASTMYLLGKVLSQQGKDAEALIEESIRILEESGLGESPICIQRMRYLSTIEGRVMGIGHP EYASTMYLLGKVLSQQGKDAEALIEESIRILEESGLGESPICIQRMRYLST(+) MHTKNEVSLHDRRTCYGDWSSRVCKHNVPSWQGVKSTRKRCRSPY*(+) MTNPHNTSFYRGEIPHSLYAYW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |