Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G28420_circ_g.8 |
| ID in PlantcircBase | ath_circ_004693 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 9981630-9981998 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G28420 |
| Parent gene annotation |
Homeobox-DDT domain protein RLT1 |
| Parent gene strand | + |
| Alternative splicing | AT1G28420_circ_g.1 AT1G28420_circ_g.2 AT1G28420_circ_g.3 AT1G28420_circ_g.4 AT1G28420_circ_g.5 AT1G28420_circ_g.6 AT1G28420_circ_g.7 AT1G28420_circ_g.9 AT1G28420_circ_g.10 AT1G28420_circ_g.11 AT1G28420_circ_g.12 AT1G28420_circ_g.13 AT1G28420_circ_g.14 AT1G28420_circ_g.15 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G28420.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.229872854 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9981846-9981995(+) |
| Potential amino acid sequence |
MRKEMERNERERRKEEERLMRERIKEEERLQREQRREVERREKFLQRENERINDGRLGRGSETR ENHGPKDLEKLEIQRKKNEERMRKEMERNERERRKEEERLMRERIKEEERLQREQRREVERREK FLQRENERINDGRLGRGSETRENHGPKDLEKLEIQRKKNEERMRKEMERNERERRKEEERLMRE RIKEEERLQREQRREVERREKFLQRENERINDGRLGRGSETRENHGPKDLEKLEIQRKKNEERM RKEMERNERERRKEEERLMRERIKEEERLQREQRREVERREKFLQRENER(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |