Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0499900_circ_g.1 |
ID in PlantcircBase | osa_circ_030969 |
Alias | Os_ciR10388 |
Organism | Oryza sativa |
Position | chr6: 17598774-17599744 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os06g0499900 |
Parent gene annotation |
Similar to Dihydrolipoamide acetyltransferase (E2) subunit of PD C (Fragment). (Os06t0499900-01) |
Parent gene strand | - |
Alternative splicing | Os06g0499900_circ_g.2 Os06g0499900_circ_g.3 Os06g0499900_circ_g.4 Os06g0499900_circ_g.5 Os06g0499900_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0499900-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.124395778 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17599740-17599292(-) |
Potential amino acid sequence |
MTPIIRNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSISNLGMYPVDHFCAIINPPQS GILAVGRGNKIIEPVVDSDGTEKATVVTKMSLTLSADHRVFDGQVGGPDDSYYKKCRSKDYISN ILRG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |