Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0499900_circ_g.4 |
| ID in PlantcircBase | osa_circ_030972 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 17599224-17599899 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0499900 |
| Parent gene annotation |
Similar to Dihydrolipoamide acetyltransferase (E2) subunit of PD C (Fragment). (Os06t0499900-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0499900_circ_g.1 Os06g0499900_circ_g.2 Os06g0499900_circ_g.3 Os06g0499900_circ_g.5 Os06g0499900_circ_g.6 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-GC |
| Number of exons covered | Os06t0499900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.12379931 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17599721-17599886(-) 17599740-17599886(-) |
| Potential amino acid sequence |
MQIKRLYQQYPQRLSSWLKRHVLGSLLLMNFREGLSAYWNNDKEQAQKCVSVDISIAVATEKGL MTPIIRNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSILEQ*(-) MTPIIRNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSILEQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |