Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0204600_circ_g.2 |
| ID in PlantcircBase | osa_circ_008786 |
| Alias | Os_ciR2662 |
| Organism | Oryza sativa |
| Position | chr11: 5278155-5278414 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0204600 |
| Parent gene annotation |
Similar to Glucose-1-phosphate adenylyltransferase. (Os11t020460 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0202300_circ_ag.1 Os11g0202300_circ_ag.2 Os11g0202300_circ_ag.3 Os11g0202450_circ_ag.1 Os11g0202600_circ_g.1 Os11g0202600_circ_g.2 Os11g0202600_circ_g.3 Os11g0202600_circ_g.4 Os11g0205500_circ_igg.1 Os11g0204600_circ_g.1 Os11g0204600_circ_g.3 Os11g0204600_circ_g.4 Os11g0205500_circ_g.1 |
| Support reads | 5/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0204600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.140424103 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5278174-5278219(+) 5278392-5278219(+) |
| Potential amino acid sequence |
MPGEAAGWFRDTADAVENFFWALEDYIAHFKLVRGSALSYGLHEAHAGISCYTNARGGCWLVPG YSRCS*(+) MDYMKLMQVLAATQMPGEAAGWFRDTADAVENFFWALEDYIAHFKLVRGSALSYGLHEAHAGIS CYTNARGGCWLVPGYSRCS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |