Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0522900_circ_g.1 |
ID in PlantcircBase | osa_circ_007732 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 20281716-20283765 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0522900 |
Parent gene annotation |
Isopenicillin N synthase family protein. (Os10t0522900-01);Simil ar to Oxidoreductase, 2OG-Fe oxygenase family protein, expressed . (Os10t0522900-02) |
Parent gene strand | + |
Alternative splicing | Os10g0522900_circ_g.2 Os10g0522900_circ_igg.1 Os10g0522900_circ_g.2 Os10g0522900_circ_igg.3 Os10g0522900_circ_ag.1 Os10g0523100_circ_igg.1 Os10g0523100_circ_igg.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0522900-01:7 Os10t0522900-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.103548878 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20281828-20281836(+) 20281756-20283447(-) |
Potential amino acid sequence |
MALLRNRNYLGYTPLGADKLDASSKFKGDLNENYCIGPIRKEGYQNDANQWPSEENFPCWKETM KLYHETALATGKRILSLIALSLNLDVEFFDCPVAFLRLLHYPGEANESDDGNYGASAHSDYGVL TLVATDGTPGLQICREKDRCPQLWEDVHHIEGALIVNIGDLLQRWTNCVFRLAWSTDSSTWSTM EPRDWRRRCSGRAASFSSSRWGRRWRC*(+) MVDHVEESVLHASLKTQLVHLCSKSPILTIRAPSM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |