Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0522900_circ_g.1 |
| ID in PlantcircBase | osa_circ_007732 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 20281716-20283765 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0522900 |
| Parent gene annotation |
Isopenicillin N synthase family protein. (Os10t0522900-01);Simil ar to Oxidoreductase, 2OG-Fe oxygenase family protein, expressed . (Os10t0522900-02) |
| Parent gene strand | + |
| Alternative splicing | Os10g0522900_circ_g.2 Os10g0522900_circ_igg.1 Os10g0522900_circ_g.2 Os10g0522900_circ_igg.3 Os10g0522900_circ_ag.1 Os10g0523100_circ_igg.1 Os10g0523100_circ_igg.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0522900-01:7 Os10t0522900-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.103548878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20281828-20281836(+) 20281756-20283447(-) |
| Potential amino acid sequence |
MALLRNRNYLGYTPLGADKLDASSKFKGDLNENYCIGPIRKEGYQNDANQWPSEENFPCWKETM KLYHETALATGKRILSLIALSLNLDVEFFDCPVAFLRLLHYPGEANESDDGNYGASAHSDYGVL TLVATDGTPGLQICREKDRCPQLWEDVHHIEGALIVNIGDLLQRWTNCVFRLAWSTDSSTWSTM EPRDWRRRCSGRAASFSSSRWGRRWRC*(+) MVDHVEESVLHASLKTQLVHLCSKSPILTIRAPSM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |