Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0760200_circ_g.3 |
ID in PlantcircBase | osa_circ_016637 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 32010782-32012190 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0760200 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0760200-01);Conserved hypo thetical protein. (Os02t0760200-02) |
Parent gene strand | + |
Alternative splicing | Os02g0760200_circ_g.2 Os02g0760200_circ_g.4 Os02g0760200_circ_g.5 Os02g0760200_circ_g.6 Os02g0760200_circ_g.7 Os02g0760200_circ_g.8 Os02g0760200_circ_g.9 Os02g0760200_circ_g.10 Os02g0760200_circ_g.11 Os02g0760200_circ_g.12 Os02g0760200_circ_g.13 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0760200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.15272597 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32012132-32010799(+) 32010839-32010806(+) 32010866-32012111(-) |
Potential amino acid sequence |
MVVDRICIVLWRFRCLHKAERLTLAN*(+) MQPGSGETHVFFPDSLGDDLIIDVSDSKGKPCGRVVAQVATMAEESTDKLRWWSIYREPEHELV GRIQLYIHYTTAADENNTKYGSVAETVAYDIVLEVAMKAQHIQQRNLILHGSWKWLLTEFALYY GVSDAYTKLRDLLLPIEA*(+) MCFTRSWLHRYNIIFRCTFKPQLARVSLSALCRHLKRHSTMQILSTTISRNHAR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |