Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0162100_circ_g.3 |
| ID in PlantcircBase | osa_circ_010535 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 3129667-3130264 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0162100 |
| Parent gene annotation |
Similar to cDNA clone:J033067N18, full insert sequence. (Os12t01 62100-01);Similar to MAP kinase-like protein. (Os12t0162100-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0162100_circ_g.1 Os12g0162100_circ_g.2 Os12g0162100_circ_g.4 Os12g0162100_circ_g.5 Os12g0162100_circ_g.6 Os12g0162100_circ_g.7 Os12g0162100_circ_g.8 Os12g0162100_circ_g.9 Os12g0162100_circ_g.10 Os12g0162100_circ_g.11 Os12g0162100_circ_g.12 Os12g0162100_circ_g.13 Os12g0162100_circ_g.14 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0162100-01:1 Os12t0162100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.430678574 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3130238-3130141(-) 3129673-3130141(-) |
| Potential amino acid sequence |
MKAMKRWAIQILTGLEYLHSQKPAIIHRDLKCDNIFINGNHGKVKIGDFGLATFMQQQKKSIKG TLEFMAPELLTGHYNELVDIYSFGMCMLEMVTCEYPYSECQGMAHIFKKIDEVPQKAQESEYEG YETMGNTDINRARISAQSEASNYTQGFKM*(-) MRYRRKHKKVNMKAMKRWAIQILTGLEYLHSQKPAIIHRDLKCDNIFINGNHGKVKIGDFGLAT FMQQQKKSIKGTLEFMAPELLTGHYNELVDIYSFGMCMLEMVTCEYPYSECQGMAHIFKKIDEV PQKAQESEYEGYETMGNTDINRARISAQSEASNYTQGFKM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |