Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0212200_circ_g.8 |
ID in PlantcircBase | osa_circ_023095 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 7512128-7516952 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0212200 |
Parent gene annotation |
Similar to protein binding protein. (Os04t0212200-01) |
Parent gene strand | + |
Alternative splicing | Os04g0212200_circ_g.3 Os04g0212200_circ_g.4 Os04g0212200_circ_g.5 Os04g0212200_circ_g.6 Os04g0212200_circ_g.7 Os04g0212200_circ_g.9 Os04g0212200_circ_g.10 Os04g0212200_circ_g.11 Os04g0212200_circ_g.12 Os04g0212200_circ_g.13 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0212200-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015083 |
PMCS | 0.102501568 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7516904-7512308(+) |
Potential amino acid sequence |
MGSTPRHRRYWREILCRWQKSRQFLTKRHGLLLMFQKSSKQLFYHYHPLIPLLMAWRCLALMTA QSSMKIGLQVKNQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |