Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0567400_circ_g.7 |
ID in PlantcircBase | osa_circ_008063 |
Alias | Os10circ10261 |
Organism | Oryza sativa |
Position | chr10: 22484633-22485340 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os10g0567400 |
Parent gene annotation |
Similar to Rieske. (Os10t0567400-01);Similar to Isoform 2 of Chl orophyllide a oxygenase, chloroplastic. (Os10t0567400-02);Simila r to Isoform 2 of Chlorophyllide a oxygenase, chloroplastic. (Os 10t0567400-03) |
Parent gene strand | - |
Alternative splicing | Os10g0567200_circ_ag.1 EPlOSAG00000036674_circ_ig.1 Os10g0567300_circ_g.1 Os10g0567300_circ_g.2 Os10g0567300_circ_g.3 Os10g0567400_circ_g.1 Os10g0567400_circ_g.2 Os10g0567400_circ_g.3 Os10g0567400_circ_g.4 Os10g0567400_circ_g.5 Os10g0567400_circ_g.6 Os10g0567400_circ_g.8 Os10g0567400_circ_g.9 Os10g0567400_circ_g.10 Os10g0567400_circ_g.11 |
Support reads | 3/3 |
Tissues | leaf/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0567400-03:2 Os10t0567400-01:3 Os10t0567400-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008724 |
PMCS | 0.534454089 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22485105-22485326(-) 22484664-22485326(-) |
Potential amino acid sequence |
METLVNDRLLQDGGSSASTAECTSLAPSTSSASRVVNKKPPRRSLNVSGPVQPYNPSLKNFWYP VAFSSDLKDDTMVPIDCFEEQWVIFRGKDGRPGCVMNTCAHRACPLHLGSVNEGRIQCPYHGGR GS*(-) MRAESNALTMVVEVLNPLAREFKSIGTLRKELAELQEELAKAHNQVHLSETRVSSALDKLAQME TLVNDRLLQDGGSSASTAECTSLAPSTSSASRVVNKKPPRRSLNVSGPVQPYNPSLKNFWYPVA FSSDLKDDTMVPIDCFEEQWVIFRGKDGRPGCVMNTCAHRACPLHLGSVNEGRIQCPYHGGRGS *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |