Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0594700_circ_g.9 |
ID in PlantcircBase | osa_circ_029227 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 29612126-29612438 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0594700 |
Parent gene annotation |
Similar to Hv711N16.16 (Fragment). (Os05t0594700-01);Similar to Hv711N16.16 (Fragment). (Os05t0594700-02) |
Parent gene strand | + |
Alternative splicing | Os05g0594700_circ_g.3 Os05g0594700_circ_g.4 Os05g0594700_circ_g.5 Os05g0594700_circ_g.6 Os05g0594700_circ_g.7 Os05g0594700_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0594700-02:2 Os05t0594700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.330429819 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29612137-29612435(+) |
Potential amino acid sequence |
MQINLLIWLRRRRNCKIGLITTSSSMKEIHQKGPPLRLAFLAVLVPRWMPLNTTKQRLRRLGKK WFTMQINLLIWLRRRRNCKIGLITTSSSMKEIHQKGPPLRLAFLAVLVPRWMPLNTTKQRLRRL GKKWFTMQINLLIWLRRRRNCKIGLITTSSSMKEIHQKGPPLRLAFLAVLVPRWMPLNTTKQRL RRLGKKWFTMQINLLIWLRRRRNCKIGLITTSSSMKEIHQKGPPLRLAFLAVLVPRWMPLNTTK QRLRRLGK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |