Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0279100_circ_g.4 |
| ID in PlantcircBase | osa_circ_038693 |
| Alias | Os_ciR5666 |
| Organism | Oryza sativa |
| Position | chr9: 5849731-5850147 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0279100 |
| Parent gene annotation |
Hypothetical conserved gene. (Os09t0279100-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0279100_circ_g.2 Os09g0279100_circ_g.3 Os09g0279100_circ_g.5 |
| Support reads | 3/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0279100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.433481515 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5850103-5849795(+) 5849822-5849819(-) |
| Potential amino acid sequence |
MLILSSRFYTGDIQEPSSSVICDSKADPDGDPSGKSF*(+) MNYFRWNFKRTYLMDLHLDQLLSRILLRMKALGCLLYRICYLKSAFDGESKLQILNGNYRIPEL PKYSSPITSLIKDMLQSSPDVRPDITQARALLDWPFTSMNLGVVPCQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |