Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0279100_circ_g.5 |
ID in PlantcircBase | osa_circ_038694 |
Alias | Os_ciR4171 |
Organism | Oryza sativa |
Position | chr9: 5849731-5850582 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os09g0279100 |
Parent gene annotation |
Hypothetical conserved gene. (Os09t0279100-01) |
Parent gene strand | - |
Alternative splicing | Os09g0279100_circ_g.2 Os09g0279100_circ_g.3 Os09g0279100_circ_g.4 |
Support reads | 2/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0279100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007990* osi_circ_018861 |
PMCS | 0.372123464 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5850287-5849742(+) 5850432-5849761(+) 5849822-5850570(-) |
Potential amino acid sequence |
MSTFSLITSLRYKSHISGALYAGVVCFRILSSSIPISSGLSKHLWLVDTLPKSHSFQAPPPPRR IFSAFRSLHPQ*(+) MQELCAFEYYPLQYPSPQVYQSTYGWSIHYQSHIVSRPHHHQEEYFQPLGPFILSNMRLKS*(+ ) MNYFRWNFKRTYLMDLHLDQLLSRILLRMKGPKG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |