Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0911800_circ_g.5 |
| ID in PlantcircBase | osa_circ_005425 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 39733887-39734804 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0911800 |
| Parent gene annotation |
Similar to Heavy meromyosin-like protein (Fragment). (Os01t09118 00-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0911800_circ_g.3 Os01g0911800_circ_g.4 Os01g0911800_circ_g.6 Os01g0911800_circ_g.7 Os01g0911800_circ_g.8 Os01g0911800_circ_g.9 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0911800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124908642 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39733983-39734755(-) |
| Potential amino acid sequence |
MTSAARTLALSSAALHSSWALAYSVLTDSSASFLKSLNSRLKMLTLLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |