Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0911800_circ_g.8 |
ID in PlantcircBase | osa_circ_005428 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 39735125-39735735 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0911800 |
Parent gene annotation |
Similar to Heavy meromyosin-like protein (Fragment). (Os01t09118 00-01) |
Parent gene strand | + |
Alternative splicing | Os01g0911800_circ_g.3 Os01g0911800_circ_g.4 Os01g0911800_circ_g.5 Os01g0911800_circ_g.6 Os01g0911800_circ_g.7 Os01g0911800_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0911800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.300744408 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39735484-39735148(+) 39735378-39735498(-) |
Potential amino acid sequence |
MIDNINSLMSELAVEREELLRALRIESSNCSKLKKRNSYTLN*(+) MALVRVSEELLSPVSRSSVAVDASLLSAEGFSIILTFSVTEVFLNLECRSFFSSAWSNWMIQFS KLAATLLAPLPTLTSRS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |