Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G28025_circ_g.1 |
ID in PlantcircBase | ath_circ_033255 |
Alias | At_ciR647 |
Organism | Arabidpsis thaliana |
Position | chr4: 13935972-13936292 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, circseq_cup, CIRI-full |
Parent gene | AT4G28025 |
Parent gene annotation |
Putative uncharacterized protein At4g28025 |
Parent gene strand | - |
Alternative splicing | AT4G28025_circ_g.2 AT4G28025_circ_g.3 |
Support reads | 21/12 |
Tissues | leaf/aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G28025.1:2 AT4G28025.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.230522897 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13936242-13935974(-) |
Potential amino acid sequence |
MVDPLEAKRLASKQMEEIKGREKQQRRREIEAINGAWAIIGLMIGLVIEAQTGKGILAQVSPPP PPGKAKVKKEVIMVDPLEAKRLASKQMEEIKGREKQQRRREIEAINGAWAIIGLMIGLVIEAQT GKGILAQVSPPPPPGKAKVKKEVIMVDPLEAKRLASKQMEEIKGREKQQRRREIEAINGAWAII GLMIGLVIEAQTGKGILAQVSPPPPPGKAKVKKEVIMVDPLEAKRLASKQMEEIKGREKQQRRR EIEAINGAWAIIGLMIGLVIEAQTGKGILAQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |