Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G120800_circ_g.2 |
| ID in PlantcircBase | gra_circ_000363 |
| Alias | Chr04:29979251|29979371 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 29979251-29979371 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | i-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G120800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.004G120800_circ_g.1 |
| Support reads | 5/20 |
| Tissues | leaf/ovule |
| Exon boundary | No-No |
| Splicing signals | CT-AC |
| Number of exons covered | 0 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.029616942 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29979335-29979321(+) |
| Potential amino acid sequence |
MTSSYPYSSPNISLFSVLKILHLLFVMFLNILLDDA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |