Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G120800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000362 |
| Alias | Chr04:29978731|29979371 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 29978731-29979371 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G120800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.004G120800_circ_g.2 |
| Support reads | 17 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G120800.2:1 Gorai.004G120800.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.977436258 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29978748-29979301(-) 29978944-29979278(-) |
| Potential amino acid sequence |
MLLTLRDVGAAVGIRRGHRGIIKRRQAVY*(-) MAFTLRSVKVPPNSASLEEARSRVFDFFRQACRSIPTIMDIYNLDDVVTKSELRSSISSEIRKN SHVTNPKRCWGCCRDKTRSSRNNQASSSSILRNITKSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |