Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0536000_circ_g.5 |
| ID in PlantcircBase | osa_circ_002065 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 19472465-19473780 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0536000 |
| Parent gene annotation |
Similar to CBL-interacting serine/threonine-protein kinase 24 (E C 2.7.1.37) (SNF1-related kinase 3.11) (SALT OVERLY SENSITIVE 2 protein). (Os01t0536000-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0536000_circ_g.2 Os01g0536000_circ_g.3 Os01g0536000_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0536000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.232847986 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19473770-19472771(+) 19472564-19473674(-) |
| Potential amino acid sequence |
MTENLRIIKSCIDIIKIDFFTFNFSGRFIILLKPFIIPDLFYPDSFIWIRVKNSVNK*(+) MMNGLRRIMNLPEKLKVKKSILMMSMQLLMILRFSVIKDMMEHLLIHGHVELFYMSCWQVIFHL MKLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |