Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d015890_circ_g.9 |
ID in PlantcircBase | zma_circ_008655 |
Alias | zma_circ_0001868 |
Organism | Zea mays |
Position | chr5: 129517023-129534601 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d015890 |
Parent gene annotation |
SNARE-interacting protein KEULE |
Parent gene strand | - |
Alternative splicing | Zm00001d015890_circ_g.1 Zm00001d015890_circ_g.2 Zm00001d015890_circ_g.3 Zm00001d015890_circ_g.4 Zm00001d015890_circ_g.5 Zm00001d015890_circ_g.6 Zm00001d015890_circ_g.7 Zm00001d015890_circ_g.8 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d015890_T002:5 Zm00001d015890_T001:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.064316199 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
129525537-129517054(+) 129525554-129525385(-) |
Potential amino acid sequence |
MSDRNMTMFSLVGWMKYMASSEGNGCLRLYKSSTTSLMQILWIYE*(+) MFLSDMSGRSPLYKKAYVFFSSPVHKELVAQIKKDSSVLPRIAALSEMNLEYFAIDSQVSIILQ KDHWFRIWGFITDHERALEELFSENAEGSHKYNACLNTMATRISTVFASMRWSKIYINGGNHCL HWMPYISSNQLKRTLSCSYPTCQEEALCTRRHMCFSVLPYIKN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |