Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d015890_circ_g.7 |
| ID in PlantcircBase | zma_circ_008654 |
| Alias | Zm05circ00081, zma_circ_0002008 |
| Organism | Zea mays |
| Position | chr5: 129504229-129517151 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d015890 |
| Parent gene annotation |
SNARE-interacting protein KEULE |
| Parent gene strand | - |
| Alternative splicing | Zm00001d015890_circ_g.1 Zm00001d015890_circ_g.2 Zm00001d015890_circ_g.3 Zm00001d015890_circ_g.4 Zm00001d015890_circ_g.5 Zm00001d015890_circ_g.6 Zm00001d015890_circ_g.8 Zm00001d015890_circ_g.9 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d015890_T002:5 Zm00001d015890_T001:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.034996756 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
129517063-129517144(-) |
| Potential amino acid sequence |
MATRISTVFASMREFPRVHYRIAKTIDASTMTTLRDLVPTKLAASVWNCLAKYKTTIPEFPQTE TCELLIVDRSIDQIAPIIHEWTYDAMCHDLLCMDGNKYVHEVPTKNGSATEKKEVLLEDHDPVW LELRHAHIADASERLHDKMTNFISKNKAAQLHQARVS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b |