Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0231900_circ_g.4 |
ID in PlantcircBase | osa_circ_000952 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 7289699-7291602 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0231900 |
Parent gene annotation |
K Homology, type 1, subgroup domain containing protein. (Os01t02 31900-01) |
Parent gene strand | + |
Alternative splicing | Os01g0231900_circ_g.1 Os01g0231900_circ_g.2 Os01g0231900_circ_g.3 Os01g0231900_circ_g.5 Os01g0231900_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0231900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.102837763 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7289707-7291332(+) 7291556-7289719(+) |
Potential amino acid sequence |
MQKQIEDETGVKIIFPSSKEETCVVLEAKTTEDIRKASEKIAKVLEEAVKSPILDYSHFISLPL AIHPSLVEKLNHFQCSILGTSSNVDSDKGEDLSEGSMDEIDHEQKQERSPSVSIKMQAHEESVR VKMDIKGSQPVEPCRSRLKMKLGSKLYFHLLRRKHVLFLKLKLLKILERLQRKLQRFLKRP*(+ ) MRSLSELKWILRAPNQWNHAEAD*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |