Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G10670_circ_g.5 |
| ID in PlantcircBase | ath_circ_001950 |
| Alias | AT1G10670_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 3536387-3536548 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, CIRI2 |
| Parent gene | AT1G10670 |
| Parent gene annotation |
ATP-citrate lyase A-1 |
| Parent gene strand | + |
| Alternative splicing | AT1G10670_circ_g.1 AT1G10670_circ_g.2 AT1G10670_circ_g.3 AT1G10670_circ_g.4 AT1G10670_circ_g.6 AT1G10670_circ_g.7 AT1G10670_circ_g.8 AT1G10670_circ_g.9 AT1G10670_circ_g.10 AT1G10670_circ_g.11 |
| Support reads | 39 |
| Tissues | root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G10670.1:1 AT1G10670.4:1 AT1G10670.3:1 AT1G10670.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.918712812 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3536393-3536545(+) |
| Potential amino acid sequence |
MSGCKGPITTFIVEPFVPHNEEYYLNVVSDRLGCSISFSECGGIEIEENWDKVEMSGCKGPITT FIVEPFVPHNEEYYLNVVSDRLGCSISFSECGGIEIEENWDKVEMSGCKGPITTFIVEPFVPHN EEYYLNVVSDRLGCSISFSECGGIEIEENWDKVEMSGCKGPITTFIVEPFVPHNEEYYLNVVSD RLGCSISFSECGGIEIEENWDK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |