Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G10670_circ_g.5 |
ID in PlantcircBase | ath_circ_001950 |
Alias | AT1G10670_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 3536387-3536548 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, CIRI2 |
Parent gene | AT1G10670 |
Parent gene annotation |
ATP-citrate lyase A-1 |
Parent gene strand | + |
Alternative splicing | AT1G10670_circ_g.1 AT1G10670_circ_g.2 AT1G10670_circ_g.3 AT1G10670_circ_g.4 AT1G10670_circ_g.6 AT1G10670_circ_g.7 AT1G10670_circ_g.8 AT1G10670_circ_g.9 AT1G10670_circ_g.10 AT1G10670_circ_g.11 |
Support reads | 39 |
Tissues | root, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G10670.1:1 AT1G10670.4:1 AT1G10670.3:1 AT1G10670.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.918712812 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3536393-3536545(+) |
Potential amino acid sequence |
MSGCKGPITTFIVEPFVPHNEEYYLNVVSDRLGCSISFSECGGIEIEENWDKVEMSGCKGPITT FIVEPFVPHNEEYYLNVVSDRLGCSISFSECGGIEIEENWDKVEMSGCKGPITTFIVEPFVPHN EEYYLNVVSDRLGCSISFSECGGIEIEENWDKVEMSGCKGPITTFIVEPFVPHNEEYYLNVVSD RLGCSISFSECGGIEIEENWDK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |