Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0598900_circ_g.1 |
| ID in PlantcircBase | osa_circ_031297 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 23614673-23615328 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0598900 |
| Parent gene annotation |
Similar to Serine-threonine kinase receptor-associated protein ( UNR-interacting protein) (WD-40 repeat protein PT-WD) (MAP activ ator with WD repeats). (Os06t0598900-01);Hypothetical gene. (Os0 6t0598900-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0598900_circ_g.2 Os06g0598900_circ_g.3 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0598900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016388 |
| PMCS | 0.404791463 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23615201-23614687(+) 23615276-23615278(-) |
| Potential amino acid sequence |
MKPSNSSHVTRCFVKFSWCCIWTIHIIDTQNLFYASSEQQVGILFLHQ*(+) MNRPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTSAE VSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDMWVHVFDFF TGEEIRYPPVAHWRRRKDFACL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |