Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0598900_circ_g.1 |
ID in PlantcircBase | osa_circ_031297 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 23614673-23615328 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0598900 |
Parent gene annotation |
Similar to Serine-threonine kinase receptor-associated protein ( UNR-interacting protein) (WD-40 repeat protein PT-WD) (MAP activ ator with WD repeats). (Os06t0598900-01);Hypothetical gene. (Os0 6t0598900-02) |
Parent gene strand | - |
Alternative splicing | Os06g0598900_circ_g.2 Os06g0598900_circ_g.3 |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0598900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016388 |
PMCS | 0.404791463 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23615201-23614687(+) 23615276-23615278(-) |
Potential amino acid sequence |
MKPSNSSHVTRCFVKFSWCCIWTIHIIDTQNLFYASSEQQVGILFLHQ*(+) MNRPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTSAE VSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDMWVHVFDFF TGEEIRYPPVAHWRRRKDFACL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |