Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G296000_circ_g.1 |
| ID in PlantcircBase | gra_circ_001283 |
| Alias | Chr11:62631414|62635952 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 62631414-62635952 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G296000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G296000.7:9 Gorai.011G296000.13:9 Gorai.011G296000.10:7 Gorai.011G296000.8:9 Gorai.011G296000.14:3 Gorai.011G296000.1:9 Gorai.011G296000.12:3 Gorai.011G296000.5:9 Gorai.011G296000.6:9 Gorai.011G296000.2:7 Gorai.011G296000.3:7 Gorai.011G296000.9:9 Gorai.011G296000.11:3 Gorai.011G296000.4:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000501* ghi_circ_000726* |
| PMCS | 0.098437842 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
62632793-62632844(+) |
| Potential amino acid sequence |
MPPPNVTGSLHMGHAMFVTLEDIMVRYHRMRGRPTLWLPGTDHAGIATQLVVERMLASEGIKRV ELGRDEFEKRVWEWKEKYGGTITNQIKRLGASCDWTRECFTLDEQLSRAVIEAFIRLHEKGLIY QGSYMVNWSPKLQTAVSDLEVEYSEEPGTLYYIKYRVAGGSRSDFLTIATTRPETLFGDVAIAV HPQWLYQTTAFSLLQSWQSRLILLRKNEYTIGGCLKAISDQNLTGKVILLSYQCHLLMLLALCT WDMQCL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |