Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Cotton_A_10102_circ_g.1 |
| ID in PlantcircBase | gar_circ_000501 |
| Alias | CA_chr2_BGI-A2_v1.0:67384797|67389300 |
| Organism | Gossypium arboreum |
| Position | chrCA_chr2_BGI-A2_v1.0: 67384797-67389300 JBrowse» |
| Reference genome | BGI-A2_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Cotton_A_10102 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 11/11 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Cotton_A_10102:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000726* gra_circ_001283* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
67386155-67386206(+) |
| Potential amino acid sequence |
MPPPNVTGSLHMGHAMFVTLEDIMVRYHRMRGRPTLWLPGTDHAGIATQLVVERMLASEGIKRV ELGRDEFEKRVWEWKEKYGGTITNQIKRLGASCDWTRECFTLDEQLSRAVIEAFIRLHEKGLIY QGSYMVNWSPKLQTAVSDLEVEYSEEPGTLYYIKYRVAGGSRSDFLTIATTRPETLFGDVAIAV HPQWLYQTTAFSLLQSWQSRLILLRKNEYTIGGCLKDISDQNLTGKVILLSYQCHLLMLLALCT WDMQCL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |