Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0783200_circ_g.4 |
| ID in PlantcircBase | osa_circ_004239 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 33189967-33191228 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0783200 |
| Parent gene annotation |
Similar to Diacylglycerol kinase. (Os01t0783200-01);Similar to D iacylglycerol kinase. (Os01t0783200-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0783200_circ_g.1 Os01g0783200_circ_g.2 Os01g0783200_circ_g.3 Os01g0783200_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0783200-01:4 Os01t0783200-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.172050337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33191189-33190570(+) 33191218-33191215(-) |
| Potential amino acid sequence |
MLFFTRLFFIESCAYQFSSLSLVLLTVETIELTFHLFQDFSSPIQKNMASYFQFPEEL*(+) MKNNLVKNNMLKEFYIPTYIFVPESPVEKVSQIPSCPVIVFINTKSGGQLGHDLIVTYRKLLNN SQVFDLLEEAPDKVLHKLYGNMERLMRDGDTVAAEIHRRLRLIVAGGDGTAGWLLGVVSDLKLV HPPPVATVPLGTGNNLPYSFGWGKRNPGTDEKSVLSFLQSVRQAKEMKIDRRKIQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |