Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0197400_circ_g.1 |
| ID in PlantcircBase | osa_circ_018370 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 5119909-5119968 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0197400 |
| Parent gene annotation |
Similar to COP9 signalosome complex subunit 4 (Signalosome subun it 4) (Constitutive photomorphogenesis protein 8) (FUSCA protein 4) (FUSCA4) (AtS4). (Os03t0197400-01);Similar to COP9 signaloso me complex subunit 4 (Signalosome subunit 4) (Constitutive photo morphogenesis protein 8) (FUSCA protein 4) (FUSCA4) (AtS4). (Os0 3t0197400-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0197400_circ_g.2 Os03g0197400_circ_g.3 Os03g0197400_circ_g.4 |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0197400-02:1 Os03t0197400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.710402798 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5119952-5119965(+) |
| Potential amino acid sequence |
MYHSFNLLVPLLQLFSVILKMYHSFNLLVPLLQLFSVILKMYHSFNLLVPLLQLFSVILKMYHS FN(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |