Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0249700_circ_g.11 |
ID in PlantcircBase | osa_circ_038564 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 3761395-3762485 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0249700 |
Parent gene annotation |
Protein phosphatase 2A A subunit (Phosphatase 2A regulatory A su bunit). (Os09t0249700-01);Similar to Phosphatase 2A regulatory A subunit. (Os09t0249700-02) |
Parent gene strand | - |
Alternative splicing | Os09g0249000_circ_ag.1 Os09g0249600_circ_ig.1 Os09g0249700_circ_g.1 Os09g0249700_circ_g.2 Os09g0249700_circ_g.3 Os09g0249700_circ_g.4 Os09g0249700_circ_g.5 Os09g0249700_circ_g.6 Os09g0249700_circ_g.7 Os09g0249700_circ_g.8 Os09g0249700_circ_g.9 Os09g0249700_circ_g.10 Os09g0249700_circ_g.12 Os09g0249700_circ_g.13 Os09g0249700_circ_g.14 Os09g0249700_circ_g.15 Os09g0249700_circ_g.16 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0249700-02:3 Os09t0249700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201342262 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3762355-3762481(-) |
Potential amino acid sequence |
MPMVRRAAASNLGKFAATVEQNYLKTEVMSIFDDLTQDDQDSVRLLAVEGCAALGKLLEPQDCV AHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEHSRG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |