Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0249700_circ_g.11 |
| ID in PlantcircBase | osa_circ_038564 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 3761395-3762485 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0249700 |
| Parent gene annotation |
Protein phosphatase 2A A subunit (Phosphatase 2A regulatory A su bunit). (Os09t0249700-01);Similar to Phosphatase 2A regulatory A subunit. (Os09t0249700-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0249000_circ_ag.1 Os09g0249600_circ_ig.1 Os09g0249700_circ_g.1 Os09g0249700_circ_g.2 Os09g0249700_circ_g.3 Os09g0249700_circ_g.4 Os09g0249700_circ_g.5 Os09g0249700_circ_g.6 Os09g0249700_circ_g.7 Os09g0249700_circ_g.8 Os09g0249700_circ_g.9 Os09g0249700_circ_g.10 Os09g0249700_circ_g.12 Os09g0249700_circ_g.13 Os09g0249700_circ_g.14 Os09g0249700_circ_g.15 Os09g0249700_circ_g.16 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0249700-02:3 Os09t0249700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201342262 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3762355-3762481(-) |
| Potential amino acid sequence |
MPMVRRAAASNLGKFAATVEQNYLKTEVMSIFDDLTQDDQDSVRLLAVEGCAALGKLLEPQDCV AHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEHSRG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |