Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0923300_circ_g.4 |
ID in PlantcircBase | osa_circ_005555 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 40387305-40388229 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0923300 |
Parent gene annotation |
Cystathionine beta-synthase, core domain containing protein. (Os 01t0923300-01) |
Parent gene strand | + |
Alternative splicing | Os01g0923300_circ_g.1 Os01g0923300_circ_g.2 Os01g0923300_circ_g.3 Os01g0923300_circ_g.5 Os01g0923300_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0923300-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.275133982 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40387322-40387318(+) 40387521-40388194(-) 40387466-40388223(-) |
Potential amino acid sequence |
MRVIAQNLPPESTTVEKVMTQTPECATVDTPILDALHTMHDGKFLHLPVLDKDGNVVTVVDVLH ITHAAIATVGNSAGSGSEATSAMMQRFWDSAMSIGPLDDDDDSRSEGSTKVASEATDVGRSAFY PASGLSNTFGFKIQDKQGRMHRFNCALEIF*(+) MEGIKDWSVNRGTFRSLGHDLLNSSRFRWEILGYNTHQNISRAQLNLCILPCLS*(-) MTFSTVVDSGGRFWAITRIKISLERS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |