Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0923300_circ_g.1 |
| ID in PlantcircBase | osa_circ_005552 |
| Alias | Os_ciR3272 |
| Organism | Oryza sativa |
| Position | chr1: 40386109-40386752 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0923300 |
| Parent gene annotation |
Cystathionine beta-synthase, core domain containing protein. (Os 01t0923300-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0923300_circ_g.2 Os01g0923300_circ_g.3 Os01g0923300_circ_g.4 Os01g0923300_circ_g.5 Os01g0923300_circ_g.6 |
| Support reads | 3/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0923300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.458808178 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40386114-40386113(+) |
| Potential amino acid sequence |
MTGERTVKRLRLSKALTIPDHTTVYEACRRMAARRVDAVLLTDSNALLCGILTDKDITTRVIAR ELKLEETPVSKVMTRNPLFVLSDTLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIA RMERAAEKGKAIAAAVEGVEKHWGASVSGR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |