Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d046545_circ_g.1 |
ID in PlantcircBase | zma_circ_009980 |
Alias | zma_circ_0003259 |
Organism | Zea mays |
Position | chr9: 95160161-95175975 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d046545 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Zm00001d046545_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d046545_T003:5 Zm00001d046545_T007:5 Zm00001d046545_T016:5 Zm00001d046545_T006:5 Zm00001d046545_T012:5 Zm00001d046545_T009:4 Zm00001d046545_T015:5 Zm00001d046545_T010:5 Zm00001d046545_T018:3 Zm00001d046545_T001:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.124102586 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
95175960-95160203(+) 95175079-95175967(-) |
Potential amino acid sequence |
MISSSSCLGLQNKSSGGKIY*(+) METSLLLGNLIDVLEEIKLSKLELVNLTSAAFVLESQTRRT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |