Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d046545_circ_g.1 |
| ID in PlantcircBase | zma_circ_009980 |
| Alias | zma_circ_0003259 |
| Organism | Zea mays |
| Position | chr9: 95160161-95175975 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d046545 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Zm00001d046545_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d046545_T003:5 Zm00001d046545_T007:5 Zm00001d046545_T016:5 Zm00001d046545_T006:5 Zm00001d046545_T012:5 Zm00001d046545_T009:4 Zm00001d046545_T015:5 Zm00001d046545_T010:5 Zm00001d046545_T018:3 Zm00001d046545_T001:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124102586 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
95175960-95160203(+) 95175079-95175967(-) |
| Potential amino acid sequence |
MISSSSCLGLQNKSSGGKIY*(+) METSLLLGNLIDVLEEIKLSKLELVNLTSAAFVLESQTRRT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |