Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d050150_circ_g.3 |
ID in PlantcircBase | zma_circ_008051 |
Alias | zma_circ_0001815, GRMZM2G030628_C3 |
Organism | Zea mays |
Position | chr4: 69411564-69411828 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d050150 |
Parent gene annotation |
Adenylate kinase 5 chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d050150_circ_g.1 Zm00001d050150_circ_g.2 Zm00001d050150_circ_g.4 Zm00001d050150_circ_g.5 Zm00001d050150_circ_g.6 Zm00001d050150_circ_g.7 Zm00001d050150_circ_g.8 Zm00001d050150_circ_g.9 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d050150_T001:2 Zm00001d050150_T002:2 Zm00001d050150_T003:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.213164694 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
69411827-69411565(+) |
Potential amino acid sequence |
MVKSRLDTYKQNSEAILPTYSDLLNKIDGNCPAEVVFQAIDFLLQKICENTSASKLTKTNG*(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |