Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d050150_circ_g.4 |
ID in PlantcircBase | zma_circ_008052 |
Alias | zma_circ_0001816 |
Organism | Zea mays |
Position | chr4: 69411564-69417887 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d050150 |
Parent gene annotation |
Adenylate kinase 5 chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d050150_circ_g.1 Zm00001d050150_circ_g.2 Zm00001d050150_circ_g.3 Zm00001d050150_circ_g.5 Zm00001d050150_circ_g.6 Zm00001d050150_circ_g.7 Zm00001d050150_circ_g.8 Zm00001d050150_circ_g.9 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d050150_T002:7 Zm00001d050150_T001:7 Zm00001d050150_T003:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.134847386 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
69417477-69411565(+) |
Potential amino acid sequence |
MDVYRIGTLMELVRELSLSFADDGKRVKVCVQGSMGQGAFAGIPLQLAGTRKILEFMDWGDYGA KGTFINIGAVG*(+) |
Sponge-miRNAs | zma-miR172c-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |