Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0474900_circ_g.3 |
ID in PlantcircBase | osa_circ_030847 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 15924652-15929138 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0474900 |
Parent gene annotation |
Conserved hypothetical protein. (Os06t0474900-01);Conserved hypo thetical protein. (Os06t0474900-02) |
Parent gene strand | - |
Alternative splicing | Os06g0474900_circ_g.2 Os06g0474900_circ_g.4 Os06g0474900_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0474900-02:10 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.219129911 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15929058-15925391(+) 15929062-15924729(+) 15929102-15924733(+) |
Potential amino acid sequence |
MDEFPLFLENPKLMQCRRDSGLIPPPSSILQCHFFQPCLKSMEKSRLLKILFIMSRSYEVCLQN PSNAFAVTFIRVSTPKGQYKAVLVVDIKSMYIQFWSTS*(+) MNSHFFWRTQSSCNVEETLDSYHLHHQYSSVISFNRVSSLWKSPVFSKSCLS*(+) MSKRLWTHTTSIINTPVSFLSTVSQVYGKVPSSQNLVYHE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |