Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0474900_circ_g.3 |
| ID in PlantcircBase | osa_circ_030847 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 15924652-15929138 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0474900 |
| Parent gene annotation |
Conserved hypothetical protein. (Os06t0474900-01);Conserved hypo thetical protein. (Os06t0474900-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0474900_circ_g.2 Os06g0474900_circ_g.4 Os06g0474900_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0474900-02:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.219129911 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15929058-15925391(+) 15929062-15924729(+) 15929102-15924733(+) |
| Potential amino acid sequence |
MDEFPLFLENPKLMQCRRDSGLIPPPSSILQCHFFQPCLKSMEKSRLLKILFIMSRSYEVCLQN PSNAFAVTFIRVSTPKGQYKAVLVVDIKSMYIQFWSTS*(+) MNSHFFWRTQSSCNVEETLDSYHLHHQYSSVISFNRVSSLWKSPVFSKSCLS*(+) MSKRLWTHTTSIINTPVSFLSTVSQVYGKVPSSQNLVYHE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |