Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0474900_circ_g.4 |
ID in PlantcircBase | osa_circ_030848 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 15927587-15929676 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0474900 |
Parent gene annotation |
Conserved hypothetical protein. (Os06t0474900-01);Conserved hypo thetical protein. (Os06t0474900-02) |
Parent gene strand | - |
Alternative splicing | Os06g0474900_circ_g.2 Os06g0474900_circ_g.3 Os06g0474900_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0474900-02:8 Os06t0474900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016188 |
PMCS | 0.112340949 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15929633-15929661(-) |
Potential amino acid sequence |
MLLHTSGHLVVRHSGITIAELLDNAVDEVNNGATFVKIDKIKCSLIDEYSLVIQDDGGGMSPES LRHCMSFGFSKKSGNSSIGQYGNGFKTSTMRLGADVIVFSCTQDNRRLTRSIGLLSYTFLTKTG CNDILVPVVDYEFDESSHTLKKIMDRGEKHFSSNLSTLLKWSPFTTEDDLLNQFGDMGCHGTKL IVFNLWFNDAWEMELDFASDEEVIRTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |