Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_08G237500_circ_g.2 |
| ID in PlantcircBase | gma_circ_002127 |
| Alias | Gm08circRNA1976 |
| Organism | Glycine max |
| Position | chr8: 20205875-20212884 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_08G237500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_08G237500_circ_g.1 GLYMA_08G237500_circ_g.3 GLYMA_08G237500_circ_g.4 GLYMA_08G237500_circ_g.5 GLYMA_08G237500_circ_g.6 |
| Support reads | NA |
| Tissues | leaf, root, stem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH44887:5 KRH44886:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.406897026 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20212757-20206168(+) 20212101-20212818(-) |
| Potential amino acid sequence |
MYRRRSIRPARTNSRSNSSGLFVAQINMIACLRDTRSTPVFSFLRYLFKIITSTISYIITKYNT FSTSTTMSYYHLHHHVTKCCIALVYHIFSRIKYRYCSFLTTRQEL*(+) MSVRKGHSKIFQQDIIDVLDKQLLEGMGVLLTEEEQQKCEQRLSFEKKRLLAVHEAGHVVLAHL FPRFDWHAFSQLLPGGKETAISVFYPREDMVDQGYTTFGYMMMQMVVAHGGRCAERIIFGDDIT DGGSDDLEKITKEGKNWCRPCIPQTSYHIYLCHK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |