Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0100900_circ_g.2 |
| ID in PlantcircBase | osa_circ_000013 |
| Alias | Os_ciR6272 |
| Organism | Oryza sativa |
| Position | chr1: 36818-38033 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0100900 |
| Parent gene annotation |
Sphingosine-1-phosphate lyase, Disease resistance response (Os01 t0100900-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0100900_circ_g.3 Os01g0100900_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0100900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.267285931 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36877-36832(+) 36850-38004(-) 36857-37936(-) |
| Potential amino acid sequence |
MFSHTNPLHQDVFKSVAQLEAEVVAMTAALLGIKEKSSGGQICGNMTSGGTESILLAVKTSRDY MRTKKGITKPEMIIAESAHSAYDKAAQYFNIKVRRVPVNKEFLADVKGFKRCINGNTIMLYCWE *(+) MTFGFTPSNITLSYFRLYTF*(-) MQNDLRIHSQQYNIIVFPFIHLLNPFTSARNSLFTGTRRTLILKY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |