Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0367100_circ_g.8 |
| ID in PlantcircBase | osa_circ_030808 |
| Alias | Os06circ09637/Os_ciR1734 |
| Organism | Oryza sativa |
| Position | chr6: 15362456-15364347 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os06g0367100 |
| Parent gene annotation |
Glycoside hydrolase, subgroup, catalytic core domain containing protein. (Os06t0367100-01);Similar to starch branching enzyme II I. (Os06t0367100-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0367100_circ_g.5 Os06g0367100_circ_g.6 Os06g0367100_circ_g.7 |
| Support reads | 2/10/3 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0367100-02:4 Os06t0367100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008317* osi_circ_019057 |
| PMCS | 0.325736416 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15364334-15364228(+) 15362462-15364238(-) |
| Potential amino acid sequence |
MAKTEIIYFTRGPFLFVFNFNPDASYQLYSVGVDEAGEYQLILNTDETKYGGRGELTSNQYMKR TSDNRVGGCRNSLELTLPSRSAQVFKLVRILRI*(+) MISVFAMRIFKFARVQILTEKFRLLRTRIAWSINNAHP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |