Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0367100_circ_g.7 |
| ID in PlantcircBase | osa_circ_030807 |
| Alias | Os_ciR4901 |
| Organism | Oryza sativa |
| Position | chr6: 15355190-15364347 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os06g0367100 |
| Parent gene annotation |
Glycoside hydrolase, subgroup, catalytic core domain containing protein. (Os06t0367100-01);Similar to starch branching enzyme II I. (Os06t0367100-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0367100_circ_g.5 Os06g0367100_circ_g.6 Os06g0367100_circ_g.8 |
| Support reads | 4/1 |
| Tissues | root/shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0367100-02:5 Os06t0367100-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297421102 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15364334-15364228(+) 15355244-15364238(-) |
| Potential amino acid sequence |
MAKTEDIMSLDGKERLISGGSPIVHHCDDTSMIIYFTRGPFLFVFNFNPDASYQLYSVGVDEAG EYQLILNTDETKYGGRGELTSNQYMKRTSDNRVGGCRNSLELTLPSRSAQVFKLVRILRI*(+) MGEPPEISLSLPSKLMISSVFAMRIFKFARVQILTEKFRLLRTRIAWSINNAHP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |