Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0367100_circ_g.7 |
ID in PlantcircBase | osa_circ_030807 |
Alias | Os_ciR4901 |
Organism | Oryza sativa |
Position | chr6: 15355190-15364347 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
Parent gene | Os06g0367100 |
Parent gene annotation |
Glycoside hydrolase, subgroup, catalytic core domain containing protein. (Os06t0367100-01);Similar to starch branching enzyme II I. (Os06t0367100-02) |
Parent gene strand | + |
Alternative splicing | Os06g0367100_circ_g.5 Os06g0367100_circ_g.6 Os06g0367100_circ_g.8 |
Support reads | 4/1 |
Tissues | root/shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0367100-02:5 Os06t0367100-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.297421102 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15364334-15364228(+) 15355244-15364238(-) |
Potential amino acid sequence |
MAKTEDIMSLDGKERLISGGSPIVHHCDDTSMIIYFTRGPFLFVFNFNPDASYQLYSVGVDEAG EYQLILNTDETKYGGRGELTSNQYMKRTSDNRVGGCRNSLELTLPSRSAQVFKLVRILRI*(+) MGEPPEISLSLPSKLMISSVFAMRIFKFARVQILTEKFRLLRTRIAWSINNAHP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |