Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G31040_circ_g.8 |
| ID in PlantcircBase | ath_circ_015809 |
| Alias | At_ciR1644 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 13209970-13210303 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | AT2G31040 |
| Parent gene annotation |
ATP synthase protein I-like protein |
| Parent gene strand | - |
| Alternative splicing | AT2G31040_circ_g.1 AT2G31040_circ_g.2 AT2G31040_circ_g.3 AT2G31040_circ_g.4 AT2G31040_circ_g.5 AT2G31040_circ_g.6 AT2G31040_circ_g.7 AT2G31040_circ_g.9 |
| Support reads | 6/1 |
| Tissues | leaf/aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G31040.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.247637635 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13210045-13209972(-) |
| Potential amino acid sequence |
MFRELRRPRGDPEVQAAKDREQYFKSKAIVSPKWKLAPTRREQEKWDRATKAATGGSDVMFREL RRPRGDPEVQAAKDREQYFKSKAIVSPKWKLAPTRREQEKWDRATKAATGGSDVMFRELRRPRG DPEVQAAKDREQYFKSKAIVSPKWKLAPTRREQEKWDRATKAATGGSDVMFRELRRPRGDPEVQ AAKDREQYFK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |