Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA001558_circ_g.8 |
ID in PlantcircBase | osi_circ_002096 |
Alias | 1:19421855|19424055 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 19421855-19424055 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA001558 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA001558_circ_igg.1 BGIOSGA001558_circ_g.1 BGIOSGA001558_circ_g.2 BGIOSGA001558_circ_g.3 BGIOSGA001558_circ_g.4 BGIOSGA001558_circ_g.5 BGIOSGA001558_circ_g.6 BGIOSGA001558_circ_g.7 BGIOSGA001558_circ_g.9 BGIOSGA001558_circ_g.10 BGIOSGA001558_circ_g.11 BGIOSGA001558_circ_g.12 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA001558-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_001867* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19424001-19424034(-) 19423986-19421897(+) |
Potential amino acid sequence |
MKLHHSVKAYQNAEKDETTKCNPDLYYNCATADKYLENYERALRGFEAAALKDPGLGADTEVQK IISLLDKLDSAMKIIWVMHI*(-) MMKLHVIPGSTHEKACQICITQIIFIALSSLSRRLMIF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |