Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0664300_circ_g.10 |
| ID in PlantcircBase | osa_circ_015865 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 26968217-26968493 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0664300 |
| Parent gene annotation |
Peptidase S8 and S53, subtilisin, kexin, sedolisin domain contai ning protein. (Os02t0664300-01);Similar to predicted protein. (O s02t0664300-02);Similar to predicted protein. (Os02t0664300-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0664300_circ_g.8 Os02g0664300_circ_g.9 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0664300-03:2 Os02t0664300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.298220909 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26968417-26968490(+) |
| Potential amino acid sequence |
MEETRDQLADALYQKGLALAEIESLKIIAAADEVVDSIDKEDLAKSLSLKPDPEDEEAQKNKKK MEETRDQLADALYQKGLALAEIESLKIIAAADEVVDSIDKEDLAKSLSLKPDPEDEEAQKNKKK MEETRDQLADALYQKGLALAEIESLKIIAAADEVVDSIDKEDLAKSLSLKPDPEDEEAQKNKKK MEETRDQLADALYQKGLALAEIESLK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |