Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0433800_circ_g.4 |
| ID in PlantcircBase | osa_circ_023880 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 21552540-21553305 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0433800 |
| Parent gene annotation |
Similar to RECQ4A; ATP binding / ATP-dependent helicase/ helicas e/ nucleic acid binding. (Os04t0433800-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0433800_circ_g.2 Os04g0433800_circ_g.3 Os04g0433800_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0433800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014379 |
| PMCS | 0.185396987 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21553274-21553244(-) |
| Potential amino acid sequence |
MEWSEQQEILRELMSPTCTYKLLYVTPEKIAKSDALLRQLENLYSRGHLSRIVIDEAHCVSQWG HDFRPDYQHLGILKQKFPQTPVLALTATATASVKEDVVQVLGLANCIIFRQSFNRPNLRQIFLQ LTLAPAWSGQNSRRY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |