Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0433800_circ_g.4 |
ID in PlantcircBase | osa_circ_023880 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 21552540-21553305 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0433800 |
Parent gene annotation |
Similar to RECQ4A; ATP binding / ATP-dependent helicase/ helicas e/ nucleic acid binding. (Os04t0433800-01) |
Parent gene strand | - |
Alternative splicing | Os04g0433800_circ_g.2 Os04g0433800_circ_g.3 Os04g0433800_circ_g.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0433800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014379 |
PMCS | 0.185396987 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21553274-21553244(-) |
Potential amino acid sequence |
MEWSEQQEILRELMSPTCTYKLLYVTPEKIAKSDALLRQLENLYSRGHLSRIVIDEAHCVSQWG HDFRPDYQHLGILKQKFPQTPVLALTATATASVKEDVVQVLGLANCIIFRQSFNRPNLRQIFLQ LTLAPAWSGQNSRRY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |